PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 904154
Common NameARALYDRAFT_904154, CCA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 613aa    MW: 67620.4 Da    PI: 5.7802
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
904154genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a +++G   W +I +++  ++t+ q++s+ qk+
           904154 24 RERWTEEEHNRFIEALRLYGRA-WQKIEEHVA-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.39E-161874IPR009057Homeodomain-like
PROSITE profilePS5129421.271973IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-92172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-162271IPR006447Myb domain, plants
SMARTSM007171.0E-122371IPR001005SANT/Myb domain
PfamPF002491.3E-122467IPR001005SANT/Myb domain
CDDcd001671.83E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
METNSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFIEALR LYGRAWQKIE EHVATKTAVQ  60
IRSHAQKFFS KVEKEAESKG VAMGQALDIA IPPPRPKRKP SNPYPRKTGS GSIPMLKAGV  120
NDGKESLGSE KVSHPEMANE DRQQSKPEEN NNLQEDNCSD CFTHQYLSAA SSMNKSSIET  180
SNASTFREFL PSREEGSQNN RVRKESNSEN YCDLNAKSLE TDNEQGPQTY PMRIPVLMPL  240
GSSITSSLSH PPSEPDSHPH IVAGDYQSLP NHIMSTLLQT PALYTAATFA SSFWPPDSSG  300
SSPVQGNSPP NLAAMAAATV AAASAWWAAN GLLPLCAPLS SGGFTSHPPS TFGPSGDVEY  360
TKTSTLQHVS AQSREQEHSE ASKGRSSLVS EEIEKKSKPD CHEHPSVTPE SDAKGSDGAG  420
DRKQVDRSSC GSNTPSSSDD VEADASERQE DGTKGEVKEM NEDTNNPQTS ESNARRSRIS  480
SNITDPWKSV SDEGRIAFQA LFSREVLPQS FTYREEHREE EQQQQERYPM ALDLNFTAQL  540
TPVDEQEEKR NTGFLGIGLD ASKLISRGRT GFKPYKRCSM EAKESRILNT NPIIHVEQKD  600
PKRMRLETQA ST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00103PBMTransfer from AT2G46830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU284220.0U28422.1 Arabidopsis thaliana DNA-binding protein CCA1 (CCA1) mRNA, complete cds.
GenBankAY5195110.0AY519511.1 Arabidopsis thaliana MYB transcription factor (At2g46830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880268.10.0hypothetical protein ARALYDRAFT_904154
SwissprotP929730.0CCA1_ARATH; Protein CCA1
TrEMBLD7LF920.0D7LF92_ARALL; CCA1 protein
STRINGscaffold_403655.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152671518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.10.0circadian clock associated 1